BMP-2, Bone Morphogenetic Protein-2, human

Thương hiệu: Bio Basic-Canada   |   Tình trạng: Còn hàng
0₫

BMP-2, Bone Morphogenetic Protein-2, human
CAT: RC219-13
Purity: >95% by SDS-PAGE and HPLC analyses.
Storage: (-15 to -20)C

[Xem tiếp]
Đóng gói:
Đơn vị tính:

Gọi ngay 0936353379 để có được giá tốt nhất!

BMP-2, Bone Morphogenetic Protein-2, human
CAT: RC219-13
Purity: >95% by SDS-PAGE and HPLC analyses.
Storage: (-15 to -20)C
Sterile: Yes
Formulation: Lyophilized from a 0.2μm filtered concentrated (1mg/ml) solution containing 10mM sodium citrate pH 3.5.

BMP-2, Bone Morphogenetic Protein-2, human: Human Bone Morphogenetic Protein 2 (BMP-2) BMPs (Bone Morphogenetic Proteins) belong to the TGF-beta superfamily of structurally related signaling proteins. BMP-2 is a potent osteoinductive cytokine, capable of inducing bone and cartilage formation in association with osteoconductive carriers such as collagen and synthetic hydroxyapatite. In addition to its osteogenic activity, BMP-2 plays an important role in cardiac morphogenesis and is expressed in a variety of tissues including lung, spleen, brain, liver, prostate ovary and small intestine. The functional form of BMP-2 is a 26 kDa protein composed of two identical 114 amino acid polypeptide chains linked by a single disulfide bond. Each BMP-2 monomer is expressed as the C-terminal part of a precursor polypeptide, which also contains a 23 amino acid signal sequence for secretion, and a 259 amino acid propeptide. After dimerization of this precursor, the covalent bonds between the propeptide (which is also a disulfide-linked homodimer) and the mature BMP-2 ligand are cleaved by a furin-type protease. 
Source: Escherichia coli. 
Molecular Weight: Approximately 26 kDa, a homodimeric protein consisting of two 115 amino acid non-glycosylated polypeptide chains. 
Quantity: 2ug/10ug/1mg 
Purity: >95% by SDS-PAGE and HPLC analyses. 
Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by the cytolysis of MC3T3-E1 cells is less than 50 ng/ml. 
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder. 
Formulation: Lyophilized from a 0.2mm filtered concentrated (1mg/ml) solution containing 10mM sodium citrate pH 3.5.
AA Sequence: MQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECP F PLADHLNSTN HAIVQTLVNS VNSKIPKACC VPTELSAISM LYLDENEKVV LKNYQDMVVE GCGCR 
Endotoxin: Less than 1EU/mg of rHuBMP-2 as determined by LAL method. 
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
, Accession number: NM_001200, UnitProt ID: P12643

Để được hỗ trợ / khắc phục sự cố sản phẩm, xin vui lòng gửi email cho chúng tôi yêu cầu của bạn tại: Email: info@labtech.com.vn Hotline: 0936353379

Giao hàng nhanh chóng

Chỉ trong vòng 24h đồng hồ

Sản phẩm chính hãng

Sản phẩm nhập khẩu 100%

Đổi trả cực kì dễ dàng

Đổi trả trong 2 ngày đầu tiên

Mua hàng tiết kiệm

Tiết kiệm hơn từ 10% - 30%

Hotline :

0936 35 33 79
Suction ball

Suction ball

Liên hệ
TDZ (Thidiazuron)

TDZ (Thidiazuron)

Liên hệ
Cholesterol

Cholesterol

Liên hệ
popup

Số lượng:

Tổng tiền: