-
-
-
Tổng tiền thanh toán:
-
BMP-2, Bone Morphogenetic Protein-2, human
Thương hiệu: Bio Basic-Canada
| Tình trạng:
Còn hàng
0₫
BMP-2, Bone Morphogenetic Protein-2, human
CAT: RC219-13
Purity: >95% by SDS-PAGE and HPLC analyses.
Storage: (-15 to -20)C
Gọi ngay 0936353379 để có được giá tốt nhất!
-
Mô tả sản phẩm
-
Hỗ trợ khách hàng
-
Đánh giá sản phẩm
BMP-2, Bone Morphogenetic Protein-2, human
CAT: RC219-13
Purity: >95% by SDS-PAGE and HPLC analyses.
Storage: (-15 to -20)C
Sterile: Yes
Formulation: Lyophilized from a 0.2μm filtered concentrated (1mg/ml) solution containing 10mM sodium citrate pH 3.5.
BMP-2, Bone Morphogenetic Protein-2, human: Human Bone Morphogenetic Protein 2 (BMP-2) BMPs (Bone Morphogenetic Proteins) belong to the TGF-beta superfamily of structurally related signaling proteins. BMP-2 is a potent osteoinductive cytokine, capable of inducing bone and cartilage formation in association with osteoconductive carriers such as collagen and synthetic hydroxyapatite. In addition to its osteogenic activity, BMP-2 plays an important role in cardiac morphogenesis and is expressed in a variety of tissues including lung, spleen, brain, liver, prostate ovary and small intestine. The functional form of BMP-2 is a 26 kDa protein composed of two identical 114 amino acid polypeptide chains linked by a single disulfide bond. Each BMP-2 monomer is expressed as the C-terminal part of a precursor polypeptide, which also contains a 23 amino acid signal sequence for secretion, and a 259 amino acid propeptide. After dimerization of this precursor, the covalent bonds between the propeptide (which is also a disulfide-linked homodimer) and the mature BMP-2 ligand are cleaved by a furin-type protease.
Source: Escherichia coli.
Molecular Weight: Approximately 26 kDa, a homodimeric protein consisting of two 115 amino acid non-glycosylated polypeptide chains.
Quantity: 2ug/10ug/1mg
Purity: >95% by SDS-PAGE and HPLC analyses.
Biological Activity: Fully biologically active when compared to standard. The ED50 as determined by the cytolysis of MC3T3-E1 cells is less than 50 ng/ml.
Physical Appearance: Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation: Lyophilized from a 0.2mm filtered concentrated (1mg/ml) solution containing 10mM sodium citrate pH 3.5.
AA Sequence: MQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECP F PLADHLNSTN HAIVQTLVNS VNSKIPKACC VPTELSAISM LYLDENEKVV LKNYQDMVVE GCGCR
Endotoxin: Less than 1EU/mg of rHuBMP-2 as determined by LAL method.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 10mM HAc to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.
, Accession number: NM_001200, UnitProt ID: P12643
Để được hỗ trợ / khắc phục sự cố sản phẩm,
xin vui lòng gửi email cho chúng tôi yêu cầu của bạn tại:
Email: info@labtech.com.vn
Hotline: 0936353379
Giao hàng nhanh chóng
Chỉ trong vòng 24h đồng hồSản phẩm chính hãng
Sản phẩm nhập khẩu 100%Đổi trả cực kì dễ dàng
Đổi trả trong 2 ngày đầu tiênMua hàng tiết kiệm
Tiết kiệm hơn từ 10% - 30%Hotline :
0936 35 33 79
